PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr018916.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 736aa    MW: 82861.1 Da    PI: 5.6038
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr018916.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS391.11.3e-1193577281373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL++cA+avss+d + a++lL+++++++s  gd+ qRla++f+++L+arla++++++y al++++ts    ++ l+a+++++e++P+++++ + a
  Pbr018916.1 357 LRTLLISCAQAVSSDDRRTANELLKQIRQHSSAFGDSSQRLAHCFANGLEARLAGTGTQIYTALSSKRTS---AADMLKAYQTYFEACPFMRVAIIFA 451
                  6789************************************************************999999...9************************ PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                  Nq+I + +e++e++HiiDf+i +G+QWpaL++ L+ R++gpp  lRiTg++ p+sg   +e+++etg+rLak++e+ +vpfe+n  +ak++e++++ee
  Pbr018916.1 452 NQMISKLAEKAETLHIIDFGILYGFQWPALIHCLSRRDGGPPkLLRITGIELPQSGfrPEERVQETGHRLAKYCERYNVPFEYNG-IAKKWEAIQYEE 548
                  **************************************9988689**********9*****************************.7*********** PP

         GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291
                  L+vk++E+laVn+ ++ ++llde+v ++s+rd+vL+l++s++P++++++  + +++++ F++rf eal ++salfd+++++++re++ r + E+e+lg
  Pbr018916.1 549 LKVKRDEVLAVNCLFRFKNLLDETVVVNSPRDAVLNLIRSMNPDIFIHSVINGSYSAPFFVTRFREALFHFSALFDMFDTNISREDQMRLMFEEEFLG 646
                  ************************************************************************************************** PP

         GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  re+vn vaceg+er+ r et+++W+ r ++aGFk++pl+ + ++++++ +++ + + ++v+e+ +++++gWk+r ++s S+W
  Pbr018916.1 647 REVVNTVACEGSERVVRPETYKQWQVRNMRAGFKQLPLDRDLMNKIRAKVKRGYHRDFMVDEDGNWMLQGWKGRIIYSSSCW 728
                  ******************************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.47331709IPR005202Transcription factor GRAS
PfamPF035144.4E-117357728IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 736 aa     Download sequence    Send to blast
MDPSSYQLPD SNSNFIDQTL SPNFNEYPSS DPFVDLSFLC QNPSNSALSP SLSPEGDDGD  60
YSDSVLRYIN QVLMEEDMET KPCMFHDPLA VQAAEKSLFE VLGGKFPPSP NQHPHNFESP  120
YGRSSATFSD HSGNNSSVLS SSTSYWDDSR SSVDVIEHKP SILQNPIPEN FVFQSKAKSQ  180
FLSNGNGLVG SYVSDPMVSN LFGENELVLQ FNRGVEEARK FLPRGQLIVD VENNKPYTVA  240
NGKAENVVVK TEKDEGEYFP TSSRGKKSHE REDADLEVGR STKQSAVYED TEADLSEIFD  300
KVLLCGGGES KPIVSEGEEV CLDEANKALQ QNGQSVGTSN GKTRAKKKGD KKEVIDLRTL  360
LISCAQAVSS DDRRTANELL KQIRQHSSAF GDSSQRLAHC FANGLEARLA GTGTQIYTAL  420
SSKRTSAADM LKAYQTYFEA CPFMRVAIIF ANQMISKLAE KAETLHIIDF GILYGFQWPA  480
LIHCLSRRDG GPPKLLRITG IELPQSGFRP EERVQETGHR LAKYCERYNV PFEYNGIAKK  540
WEAIQYEELK VKRDEVLAVN CLFRFKNLLD ETVVVNSPRD AVLNLIRSMN PDIFIHSVIN  600
GSYSAPFFVT RFREALFHFS ALFDMFDTNI SREDQMRLMF EEEFLGREVV NTVACEGSER  660
VVRPETYKQW QVRNMRAGFK QLPLDRDLMN KIRAKVKRGY HRDFMVDEDG NWMLQGWKGR  720
IIYSSSCWVP SRSRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-423617288374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009375902.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM5WJU60.0M5WJU6_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03790.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14